SPPS : Sequence-based Protein Partner Search  
Introduction   Query One   Query Two   Result   Document   Forum
seq

Query1 Mode

You should select one of the database, input the protein sequence in FASTA format, supply your email address, and select the parameters, so that the result will be sent to you.


Your Email submit anonymously and check the result online.
Database
Search

*Enter the query protein sequence, only FASTA format is supported.
 
Example Sequence:
>BRSM1_HUMAN
MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDD
EDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPE
YTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKL
LLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPS
KRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDG

  

 

Job queue status
| Contact
Drug Discovery and Design Center(DDDC), SIMM, CAS
Total Visit: Since 2006-8Since 2006-8Since 2006-8Since 2006-8Since 2006-8 | Update: 2010-10-30 | Best View 1024*768 | Current Server Time: 2017-02-24 9:20am